Details of Protein
General Information of Protein (ID: PRT00711) | |||||
---|---|---|---|---|---|
Name | Feline leukemia virus C receptor 2 (FLVCR2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Calcium-chelate transporter; CCT; FLVCR2; C14orf58
|
||||
Gene Name | FLVCR2 | Gene ID | |||
UniProt ID | |||||
Family | Major facilitator superfamily (MFS) | ||||
TC Number | TC: 2.A.1.28.4 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQ
PSGLAHPSSSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSA FAIDWLSMCYMLTYIPLLLPVAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVT VVGQLICSVAQVFILGMPSRIASVWFGANEVSTACSVAVFGNQLGIAIGFLVPPVLVPNI EDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPPSRAQSLSYALTSPDASYLGS IARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLG AVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLP LGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDNYGTKPGNIFLCVFLTLG AALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL |
||||
Function | Acts as an importer of heme. Also acts as a transporter for a calcium-chelator complex, important for growth and calcium metabolism. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organo heterocyclic compounds | ||||||
Heme | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of FLVCR2 | |||||
Induced Change | Heme concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Urinary retention [ICD-11: GC01] | |||||
Details | It is reported that overexpression of FLVCR2 leads to the increase of heme levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | The Fowler syndrome-associated protein FLVCR2 is an importer of heme. Mol Cell Biol. 2010 Nov;30(22):5318-24. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.