Details of Protein
| General Information of Protein (ID: PRT00711) | |||||
|---|---|---|---|---|---|
| Name | Feline leukemia virus C receptor 2 (FLVCR2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Calcium-chelate transporter; CCT; FLVCR2; C14orf58
|
||||
| Gene Name | FLVCR2 | Gene ID | |||
| UniProt ID | |||||
| Family | Major facilitator superfamily (MFS) | ||||
| TC Number | TC: 2.A.1.28.4 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQ
PSGLAHPSSSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSA FAIDWLSMCYMLTYIPLLLPVAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVT VVGQLICSVAQVFILGMPSRIASVWFGANEVSTACSVAVFGNQLGIAIGFLVPPVLVPNI EDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPPSRAQSLSYALTSPDASYLGS IARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLG AVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLP LGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDNYGTKPGNIFLCVFLTLG AALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL |
||||
| Function | Acts as an importer of heme. Also acts as a transporter for a calcium-chelator complex, important for growth and calcium metabolism. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organo heterocyclic compounds | ||||||
| Heme | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Overexpression of FLVCR2 | |||||
| Induced Change | Heme concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Urinary retention [ICD-11: GC01] | |||||
| Details | It is reported that overexpression of FLVCR2 leads to the increase of heme levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The Fowler syndrome-associated protein FLVCR2 is an importer of heme. Mol Cell Biol. 2010 Nov;30(22):5318-24. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

