Details of Protein
General Information of Protein (ID: PRT00704) | |||||
---|---|---|---|---|---|
Name | Solute carrier family 16 member 12 (SLC16A12) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
MCT 12; Creatine transporter 2; CRT2; Monocarboxylate transporter 12; SLC16A12; MCT12
|
||||
Gene Name | SLC16A12 | Gene ID | |||
UniProt ID | |||||
Family | Monocarboxylate porter (MNP) | ||||
TC Number | TC: 2.A.1.13.14 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MPSGSHWTANSSKIITWLLEQPGKEEKRKTMAKVNRARSTSPPDGGWGWMIVAGCFLVTI
CTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIML GGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAM SGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDHTTPEQNH VCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYSFLLMSDFVVLAVSVLFMAYGCSPL FVYLVPYALSVGVSHQQAAFLMSILGVIDIIGNITFGWLTDRRCLKNYQYVCYLFAVGMD GLCYLCLPMLQSLPLLVPFSCTFGYFDGAYVTLIPVVTTEIVGTTSLSSALGVVYFLHAV PYLVSPPIAGRLVDTTGSYTAAFLLCGFSMIFSSVLLGFARLIKRMRKTQLQFIAKESDP KLQLWTNGSVAYSVARELDQKHGEPVATAVPGYSLT |
||||
Function | Proton-linked monocarboxylate transporter that mediates creatine transport across the plasma membrane. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Creatine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Mutation (G407S) of SLC16A12 | |||||
Induced Change | Creatine concentration: decrease (FC = 0.57) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that mutation (G407S) of SLC16A12 leads to the decrease of creatine levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | The cataract and glucosuria associated monocarboxylate transporter MCT12 is a new creatine transporter. Hum Mol Genet. 2013 Aug 15;22(16):3218-26. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.