Details of Protein

General Information of Protein (ID: PRT00702)
Name Monocarboxylate transporter 1 (SLC16A1)
Synonyms   Click to Show/Hide Synonyms of This Protein
MCT 1; Solute carrier family 16 member 1; SLC16A1; MCT1
Gene Name SLC16A1 Gene ID
6566
UniProt ID
P53985
Family Monocarboxylate porter (MNP)
TC Number   TC: 2.A.1.13.1  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Monocarboxylate Transporter (MCT) Family
TC: 2.A.1.13.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSW
ISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIG
GLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLI
LGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQ
EKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAF
LLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYA
GFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKA
AESPDQKDTDGGPKEEESPV
Structure
6LYY ; 6LZ0 ; 7CKO ; 7CKR ; 7DA5
Function Proton-coupled monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. Depending on the tissue and on cicumstances, mediates the import or export of lactic acid and ketone bodies. Required for normal nutrient assimilation, increase of white adipose tissue and body weight gain when on a high-fat diet. Plays a role in cellular responses to a high-fat diet by modulating the cellular levels of lactate and pyruvate, small molecules that contribute to the regulation of central metabolic pathways and insulin secretion, with concomitant effects on plasma insulin levels and blood glucose homeostasis.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Lactic acid Click to Show/Hide the Full List of Regulating Pair(s):   5 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Chloromercuribenzenesulfonic acid (pCMBS)) of SLC16A1
                      Induced Change Lactic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of SLC16A1 leads to the decrease of lactic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Diclofenac) of SLC16A1
                      Induced Change Lactic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of SLC16A1 leads to the decrease of lactic acid levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (Chloromercuribenzenesulfonic acid (pCMBS)) of SLC16A1
                      Induced Change Lactic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of SLC16A1 leads to the increase of lactic acid levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (AR-C155858) of SLC16A1
                      Induced Change Lactic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of SLC16A1 leads to the decrease of lactic acid levels compared with control group.
               Regulating Pair (5) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (AR-C155858) of SLC16A1
                      Induced Change Lactic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of SLC16A1 leads to the increase of lactic acid levels compared with control group.
            Pyroglutamic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Overexpression of SLC16A1
                      Induced Change Pyroglutamic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC16A1 leads to the increase of pyroglutamic acid levels compared with control group.
References
1 Monocarboxylate transporter 4 (MCT4) is a high affinity transporter capable of exporting lactate in high-lactate microenvironments. J Biol Chem. 2019 Dec 27;294(52):20135-20147.
2 Functional characterization of 5-oxoproline transport via SLC16A1/MCT1. J Biol Chem. 2015 Jan 23;290(4):2303-11.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.