Details of Protein
General Information of Protein (ID: PRT00700) | |||||
---|---|---|---|---|---|
Name | Glucose transporter type 11 (GLUT-11) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 11; SLC2A11; GLUT11
|
||||
Gene Name | SLC2A11 | Gene ID | |||
UniProt ID | |||||
Family | Sugar transporter (ST) | ||||
TC Number | TC: 2.A.1.1.44 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MRALRRLIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEPLPD
HLVLLMWSLIVSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGS FEMIMLGRLLVGVNAGVSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLRE LLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLA GELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYASSVF RKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCWGSIFTVALC LQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWIMLI LVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISKELHRLNFPRRA QGPTWRSLEVIQSTEL |
||||
Function | Facilitative glucose transporter. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of SLC2A11 | |||||
Induced Change | Glucose concentration: increase (FC = 2.5) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that overexpression of SLC2A11 leads to the increase of glucose levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Cloning and characterization of glucose transporter 11, a novel sugar transporter that is alternatively spliced in various tissues. Mol Genet Metab. 2002 May;76(1):37-45. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.