Details of Protein
| General Information of Protein (ID: PRT00699) | |||||
|---|---|---|---|---|---|
| Name | Glucose transporter type 7 (GLUT-7) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 7; hGLUT7; SLC2A7; GLUT7
|
||||
| Gene Name | SLC2A7 | Gene ID | |||
| UniProt ID | |||||
| Family | Sugar transporter (ST) | ||||
| TC Number | TC: 2.A.1.1.37 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETY
FERHATFMDGKLMLLLWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAI LMGVSKVAKAFELIVFSRVVLGVCAGISYSALPMYLGELAPKNLRGMVGTMTEVFVIVGV FLAQIFSLQAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKGDEATARQAL RRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLRWQLLSIIVLMAGQQLSGIN AINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLGRRHLLLAGYGICGS ACLVLTVVLLFQNRVPELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMV DGAVHWLTNFIIGFLFPSIQEAIGAYSFIIFAGICLLTAIYIYVVIPETKGKTFVEINRI FAKRNRVKLPEEKEETIDAGPPTASPAKETSF |
||||
| Structure | |||||
| Function | Probable sugar transporter. Its physiological substrate is subject to discussion. Does not transport galactose, 2-deoxy-d-glucose and xylose. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Fructose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mutation (I314V) of SLC2A7 | |||||
| Induced Change | Fructose concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that mutation (I314V) of SLC2A7 leads to the decrease of fructose levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Identification of a hydrophobic residue as a key determinant of fructose transport by the facilitative hexose transporter SLC2A7 (GLUT7). J Biol Chem. 2005 Dec 30;280(52):42978-83. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

