Details of Protein
General Information of Protein (ID: PRT00699) | |||||
---|---|---|---|---|---|
Name | Glucose transporter type 7 (GLUT-7) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Solute carrier family 2, facilitated glucose transporter member 7; hGLUT7; SLC2A7; GLUT7
|
||||
Gene Name | SLC2A7 | Gene ID | |||
UniProt ID | |||||
Family | Sugar transporter (ST) | ||||
TC Number | TC: 2.A.1.1.37 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETY
FERHATFMDGKLMLLLWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAI LMGVSKVAKAFELIVFSRVVLGVCAGISYSALPMYLGELAPKNLRGMVGTMTEVFVIVGV FLAQIFSLQAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKGDEATARQAL RRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLRWQLLSIIVLMAGQQLSGIN AINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLGRRHLLLAGYGICGS ACLVLTVVLLFQNRVPELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMV DGAVHWLTNFIIGFLFPSIQEAIGAYSFIIFAGICLLTAIYIYVVIPETKGKTFVEINRI FAKRNRVKLPEEKEETIDAGPPTASPAKETSF |
||||
Structure | |||||
Function | Probable sugar transporter. Its physiological substrate is subject to discussion. Does not transport galactose, 2-deoxy-d-glucose and xylose. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic oxygen compounds | ||||||
Fructose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Mutation (I314V) of SLC2A7 | |||||
Induced Change | Fructose concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that mutation (I314V) of SLC2A7 leads to the decrease of fructose levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Identification of a hydrophobic residue as a key determinant of fructose transport by the facilitative hexose transporter SLC2A7 (GLUT7). J Biol Chem. 2005 Dec 30;280(52):42978-83. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.