Details of Protein

General Information of Protein (ID: PRT00697)
Name Proton myo-inositol cotransporter (SLC2A13)
Synonyms   Click to Show/Hide Synonyms of This Protein
H(+)-myo-inositol cotransporter; Hmit; H(+)-myo-inositol symporter; Solute carrier family 2 member 13; Slc2a13
Gene Name Slc2a13 Gene ID
171147
UniProt ID
Q921A2
Family Sugar transporter (ST)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSRKASEDVEYTLRSLSSLMGERRRRQPEPGAPGGERSLLAAESAASLQGAELERAARRQ
FQRDETPAFVYAAAAFSALGGFLFGYDTGVVSGAMLLLRRQMRLGAMWQELLVSGAVGAA
AVAALAGGALNGALGRRSAILLASALCTVGSAVLAAAANKETLLAGRLVVGLGIGIASMT
VPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAIPAVI
QFLGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIRNSIEEEEKEASAAGP
IICRMLSYPPTRRALAVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITA
FTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALTILALGFLLSAQVSPRVTFRPTAPSG
QNATCTEYSYCNECMLDPDCGFCYKINSSAVIDSSCVPVNKASTNEAAWGRCENETKFKA
EDVHWAYSFCPTPYSWTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGI
NWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEIESLFDH
RLCTCGTADSDEGRYIEYIRVKGSNYHLSDNDASDVE
Function H(+)-myo-inositol cotransporter. Can also transport related stereoisomers.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic oxygen compounds
            myo-Inositol Click to Show/Hide the Full List of Regulating Pair(s):   6 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (LL22/23AA+YIRV599/602AIRA) of Slc2a13
                      Induced Change myo-Inositol concentration: increase (FC = 6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (LL22/23AA+YIRV599/602AIRA) of Slc2a13 leads to the increase of myo-inositol levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (RRR4/6AAA +LL22/23AA) of Slc2a13
                      Induced Change myo-Inositol concentration: increase (FC = 6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (RRR4/6AAA +LL22/23AA) of Slc2a13 leads to the increase of myo-inositol levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (RRR4/6AAA +LL22/23AA+YIRV599/602AIRA) of Slc2a13
                      Induced Change myo-Inositol concentration: increase (FC = 120)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (RRR4/6AAA +LL22/23AA+YIRV599/602AIRA) of Slc2a13 leads to the increase of myo-inositol levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (RRR4/6AAA+YIRV599/602AIRA) of Slc2a13
                      Induced Change myo-Inositol concentration: increase (FC = 6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (RRR4/6AAA+YIRV599/602AIRA) of Slc2a13 leads to the increase of myo-inositol levels compared with control group.
               Regulating Pair (5) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (YIRV599/602AIRA) of Slc2a13
                      Induced Change myo-Inositol concentration: increase (FC = 6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (YIRV599/602AIRA) of Slc2a13 leads to the increase of myo-inositol levels compared with control group.
               Regulating Pair (6) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (LL22/23AA) of Slc2a13
                      Induced Change myo-Inositol concentration: increase (FC = 6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (LL22/23AA) of Slc2a13 leads to the increase of myo-inositol levels compared with control group.
References
1 Identification of a mammalian H(+)-myo-inositol symporter expressed predominantly in the brain. EMBO J. 2001 Aug 15;20(16):4467-77.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.