Details of Protein
| General Information of Protein (ID: PRT00696) | |||||
|---|---|---|---|---|---|
| Name | Solute carrier family 16 member 12 (SLC16A12) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
MCT 12; Monocarboxylate transporter 12; Slc16a12; Mct12
|
||||
| Gene Name | Slc16a12 | Gene ID | |||
| UniProt ID | |||||
| Family | Monocarboxylate porter (MNP) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MTKITRVSLASPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDYSQTAWI
HSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVLTG LGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLIL GGFVLNLCVCGALMRPITLKEDRSVPEKNHNRESQREDCKQASPYSPLTKECTETRLCCS LQQEYGFLLMSDFVVLAVSVLFMAYGCSPLFVYLVPYALSVGVSHHQAAFLMSILGVIDI VGNITFGWLTDRRCLKNYRYVCYLFAVALDGLCYLCLPMLQTFPLLVPFSCTFGYFDGAY VTLIPVVTAEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGWLVDTTGSYTAAFLLCGFAM IFSSILLGFVRIVKRMKRTQVPFPVKDSDPKLQLWTNGSVAYSVARELDQKDEEPLPKAR SGCNLT |
||||
| Function | Proton-linked monocarboxylate transporter that mediates creatine transport across the plasma membrane. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Creatine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Slc16a12 | |||||
| Induced Change | Creatine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Slc16a12 leads to the increase of creatine levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The cataract and glucosuria associated monocarboxylate transporter MCT12 is a new creatine transporter. Hum Mol Genet. 2013 Aug 15;22(16):3218-26. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

