Details of Protein
| General Information of Protein (ID: PRT00670) | |||||
|---|---|---|---|---|---|
| Name | GPCR84 receptor (GPR84) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Gpr84
|
||||
| Gene Name | Gpr84 | Gene ID | |||
| UniProt ID | |||||
| Family | GPCR rhodopsin (GPCR-1) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MWNSSDANFSCYHESVLGYRYFAVIWGVAVAVTGTVGNVLTLLALAIRPKLRTRFNLLIA
NLTLADLLYCTLLQPFSVDTYLHLHWRTGAVFCRIFGLLLFTSNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVGSWVVGVTSFAPLWNVFVLVPVVCTCSFDRMRGRPYTT ILMGIYFVLGLSSVGVFYCLIHRQVKRAARALDQYGLHQASIRSHQVAGTQEAMPGHFQE LDSGVASRGPSEGISSEPVSAATTQTLEGDSSEAGGQGIRKAAQQIAERSLPEVHRKPRE TAGARRATDAPSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARGRAPRVVHMVAANLTW LNSCINPVLYAAMNRQFRHAYGSILKRGPQSFRRFH |
||||
| Function | Receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. Not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose addition (16 hours) | |||||
| Induced Change | GPR84 mRNA levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Diabetes mellitus [ICD-11: 5A14] | |||||
| Details | It is reported that glucose addition causes the increase of GPR84 mRNA levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Activation of the Immune-Metabolic Receptor GPR84 Enhances Inflammation and Phagocytosis in Macrophages. Front Immunol. 2018 Jun 20;9:1419. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

