Details of Protein
General Information of Protein (ID: PRT00670) | |||||
---|---|---|---|---|---|
Name | GPCR84 receptor (GPR84) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Gpr84
|
||||
Gene Name | Gpr84 | Gene ID | |||
UniProt ID | |||||
Family | GPCR rhodopsin (GPCR-1) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MWNSSDANFSCYHESVLGYRYFAVIWGVAVAVTGTVGNVLTLLALAIRPKLRTRFNLLIA
NLTLADLLYCTLLQPFSVDTYLHLHWRTGAVFCRIFGLLLFTSNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVGSWVVGVTSFAPLWNVFVLVPVVCTCSFDRMRGRPYTT ILMGIYFVLGLSSVGVFYCLIHRQVKRAARALDQYGLHQASIRSHQVAGTQEAMPGHFQE LDSGVASRGPSEGISSEPVSAATTQTLEGDSSEAGGQGIRKAAQQIAERSLPEVHRKPRE TAGARRATDAPSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARGRAPRVVHMVAANLTW LNSCINPVLYAAMNRQFRHAYGSILKRGPQSFRRFH |
||||
Function | Receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. Not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glucose addition (16 hours) | |||||
Induced Change | GPR84 mRNA levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Diabetes mellitus [ICD-11: 5A14] | |||||
Details | It is reported that glucose addition causes the increase of GPR84 mRNA levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Activation of the Immune-Metabolic Receptor GPR84 Enhances Inflammation and Phagocytosis in Macrophages. Front Immunol. 2018 Jun 20;9:1419. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.