Details of Protein
| General Information of Protein (ID: PRT00665) | |||||
|---|---|---|---|---|---|
| Name | G-protein coupled receptor 34 (GPR34) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Gpr34
|
||||
| Gene Name | Gpr34 | Gene ID | |||
| UniProt ID | |||||
| Family | GPCR rhodopsin (GPCR-1) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MTTTSVDSWLCSSHGMHFITNYSDQASQNFSGVPNVTSCPMDEKLLSTVLTTFYSVIFLV
GLVGNIIALYVFLGIHRKRNSIQIYLLNVAVADLLLIFCLPFRIMYHINQNKWTLGVILC KVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRRAITTKQSIYVCCIVWTVALAGFL TMIILTLKKGGHNSTMCFHYRDRHNAKGEAIFNFVLVVMFWLIFLLIILSYIKIGKNLLR ISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIIHK TNEIMLVFSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQSEASRSESTSEFKPGHSLHD LSVTVKMPQYSTKGN |
||||
| Function | Orphan receptor. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Lipids and lipid-like molecules | ||||||
| LysoPS(18:0/0:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | LysoPS(18:0/0:0) addition (4 hours) | |||||
| Induced Change | GPR34 protein activity levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Anaphylaxis [ICD-11: 4A84] | |||||
| Details | It is reported that lysoPS(18:0/0:0) addition causes the increase of GPR34 protein activity compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Identification of a lysophosphatidylserine receptor on mast cells. Biochem Biophys Res Commun. 2006 Mar 24;341(4):1078-87. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

