Details of Protein
General Information of Protein (ID: PRT00665) | |||||
---|---|---|---|---|---|
Name | G-protein coupled receptor 34 (GPR34) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Gpr34
|
||||
Gene Name | Gpr34 | Gene ID | |||
UniProt ID | |||||
Family | GPCR rhodopsin (GPCR-1) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MTTTSVDSWLCSSHGMHFITNYSDQASQNFSGVPNVTSCPMDEKLLSTVLTTFYSVIFLV
GLVGNIIALYVFLGIHRKRNSIQIYLLNVAVADLLLIFCLPFRIMYHINQNKWTLGVILC KVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRRAITTKQSIYVCCIVWTVALAGFL TMIILTLKKGGHNSTMCFHYRDRHNAKGEAIFNFVLVVMFWLIFLLIILSYIKIGKNLLR ISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIIHK TNEIMLVFSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQSEASRSESTSEFKPGHSLHD LSVTVKMPQYSTKGN |
||||
Function | Orphan receptor. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Lipids and lipid-like molecules | ||||||
LysoPS(18:0/0:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | LysoPS(18:0/0:0) addition (4 hours) | |||||
Induced Change | GPR34 protein activity levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Anaphylaxis [ICD-11: 4A84] | |||||
Details | It is reported that lysoPS(18:0/0:0) addition causes the increase of GPR34 protein activity compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Identification of a lysophosphatidylserine receptor on mast cells. Biochem Biophys Res Commun. 2006 Mar 24;341(4):1078-87. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.