Details of Protein
| General Information of Protein (ID: PRT00660) | |||||
|---|---|---|---|---|---|
| Name | G-protein coupled receptor 174 (GPR174) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
FKSG79; GPCR17; GPR174
|
||||
| Gene Name | GPR174 | Gene ID | |||
| UniProt ID | |||||
| Family | GPCR rhodopsin (GPCR-1) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMIN
LAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFL MYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLA QSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFL ICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFR RRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC |
||||
| Function | Putative receptor for purines coupled to G-proteins. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Lipids and lipid-like molecules | ||||||
| LysoPS(18:0/0:0) | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | LysoPS(18:0/0:0) addition (24 hours) | |||||
| Induced Change | GPR174 protein activity levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that lysoPS(18:0/0:0) addition causes the increase of GPR174 protein activity compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | TGF shedding assay: an accurate and versatile method for detecting GPCR activation. Nat Methods. 2012 Oct;9(10):1021-9. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

