Details of Protein

General Information of Protein (ID: PRT00659)
Name Glucose-dependent insulinotropic receptor (GPR119)
Synonyms   Click to Show/Hide Synonyms of This Protein
G-protein coupled receptor 119; GPR119
Gene Name GPR119 Gene ID
139760
UniProt ID
Q8TDV5
Family GPCR rhodopsin (GPCR-1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISG
LLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGF
VAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLL
FVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTP
FLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV
LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG
Function Receptor for the endogenous fatty-acid ethanolamide oleoylethanolamide (OEA) and lysophosphatidylcholine (LPC). Functions as a glucose-dependent insulinotropic receptor. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Seems to act through a G(s) mediated pathway.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic nitrogen compounds
            Oleoylethanolamide Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Oleoylethanolamide addition (24 hours)
                      Induced Change GPR119 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that oleoylethanolamide addition causes the increase of GPR119 protein expression compared with control group.
References
1 Deorphanization of a G protein-coupled receptor for oleoylethanolamide and its use in the discovery of small-molecule hypophagic agents. Cell Metab. 2006 Mar;3(3):167-75.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.