Details of Protein

General Information of Protein (ID: PRT00639)
Name Orexin receptor type 1 (HCRTR1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Ox-1-R; Ox1-R; Ox1R; Hypocretin receptor type 1; HCRTR1
Gene Name HCRTR1 Gene ID
3061
UniProt ID
O43613
Family GPCR rhodopsin (GPCR-1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Structure
4ZJ8 ; 4ZJC ; 6TO7 ; 6TOD ; 6TOS ; 6TOT ; 6TP3 ; 6TP4 ; 6TP6 ; 6TQ4 ; 6TQ6 ; 6TQ7 ; 6TQ9 ; 6V9S
Function Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            ATP Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (SB334867) of HCRTR1
                      Induced Change ATP concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that inhibition of HCRTR1 leads to the decrease of ATP levels compared with control group.
      Organic acids and derivatives
            Lactic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (SB334867) of HCRTR1
                      Induced Change Lactic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that inhibition of HCRTR1 leads to the increase of lactic acid levels compared with control group.
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (SB334867) of HCRTR1
                      Induced Change Glucose concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that inhibition of HCRTR1 leads to the decrease of glucose levels compared with control group.
References
1 Orexin A affects HepG2 human hepatocellular carcinoma cells glucose metabolism via HIF-1-dependent and -independent mechanism. PLoS One. 2017 Sep 8;12(9):e0184213.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.