Details of Protein
General Information of Protein (ID: PRT00635) | |||||
---|---|---|---|---|---|
Name | Glutamate receptor mGLU3 (mGluR3) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
mGluR3; Grm3; Gprc1c; Mglur3
|
||||
Gene Name | Grm3 | Gene ID | |||
UniProt ID | |||||
Family | GPCR glutamate (GPCR-3) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MKMLTRLQVLMLALFSKGFLVSLGDHNFMRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD KSRYDYFARTVPPDFYQAKAMAEILRYFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRVNASFTWVAS DGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ CSLQNKRNHRQICDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD AMKILDGKKLYKDYLLKINFTAPFNPNKGADSIVKFDTYGDGMGRYNVFNFQHIGGKYSY LKVGHWAETLYLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL VDEFTCMDCGPGQWPTADLSGCYNLPEDYIRWEDAWAIGPVTIACLGFMCTCIVITVFIK HNNTPLVKASGRELCYILLFGVSLSYCMTFFFIAKPSPVICALRRLGLGTSFAICYSALL TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILETPGTRRYTLP EKRETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIVLFQPQKNVVTHRLH LNRFSVSGTATTYSQSSASTYVPTVCNGREVLDSTTSSL |
||||
Function | G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate cyclase activity. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Benzenoids | ||||||
3,4-Dihydroxybenzeneacetic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of Grm3 | |||||
Induced Change | 3,4-Dihydroxybenzeneacetic acid concentration: decrease (FC = 0.72) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockout of mGlu2/3 leads to the decrease of 3,4-dihydroxybenzeneacetic acid levels compared with control group. | |||||
Dopamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of Grm3 | |||||
Induced Change | Dopamine concentration: decrease (FC = 0.75) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockout of mGlu2/3 leads to the decrease of dopamine levels compared with control group. | |||||
Homovanillic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of Grm3 | |||||
Induced Change | Homovanillic acid concentration: decrease (FC = 0.78) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockout of mGlu2/3 leads to the decrease of homovanillic acid levels compared with control group. | |||||
Vanylglycol | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of Grm3 | |||||
Induced Change | Vanylglycol concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockout of mGlu2/3 leads to the increase of vanylglycol levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Decreased striatal dopamine in group II metabotropic glutamate receptor (mGlu2/mGlu3) double knockout mice. BMC Neurosci. 2013 Sep 22;14:102. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.