Details of Protein

General Information of Protein (ID: PRT00625)
Name Cationic amino acid transporter 2 (SLC7A2)
Synonyms   Click to Show/Hide Synonyms of This Protein
CAT-2; CAT2; Low affinity cationic amino acid transporter 2; Solute carrier family 7 member 2; SLC7A2; ATRC2; CAT2
Gene Name SLC7A2 Gene ID
6542
UniProt ID
P52569
Family Amino acid/polyamine transporter (AAPT)
TC Number   TC: 2.A.3.3.8  (Click to Show/Hide the Complete TC Tree)
Amino acid/polyamine transporter (AAPT)
The Cationic Amino Acid Transporter (CAT) Family
TC: 2.A.3.3.8
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MIPCRAALTFARCLIRRKIVTLDSLEDTKLCRCLSTMDLIALGVGSTLGAGVYVLAGEVA
KADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLI
LSYVIGTSSVARAWSGTFDELLSKQIGQFLRTYFRMNYTGLAEYPDFFAVCLILLLAGLL
SFGVKESAWVNKVFTAVNILVLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENG
TSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCF
MAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVGWGPAKYVVAAGSLCALSTSLLGSIFPM
PRVIYAMAEDGLLFKCLAQINSKTKTPIIATLSSGAVAALMAFLFDLKALVDMMSIGTLM
AYSLVAACVLILRYQPGLSYDQPKCSPEKDGLGSSPRVTSKSESQVTMLQRQGFSMRTLF
CPSLLPTQQSASLVSFLVGFLAFLVLGLSVLTTYGVHAITRLEAWSLALLALFLVLFVAI
VLTIWRQPQNQQKVAFMVPFLPFLPAFSILVNIYLMVQLSADTWVRFSIWMAIGFLIYFS
YGIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHEKTSEF
Function Functions as permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine); the affinity for its substrates differs between isoforms created by alternative splicing. Isoform 1 functions as permease that mediates the transport of the cationic amino acids (arginine, lysine and ornithine), and it has much higher affinity for arginine than isoform 2. Isoform 2 functions as low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). May play a role in classical or alternative activation of macrophages via its role in arginine transport.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC7A2
                      Induced Change Arginine concentration: increase (FC = 1.49 - 2.61)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC7A2 leads to the increase of arginine levels compared with control group.
            Asymmetric dimethylarginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC7A2
                      Induced Change Asymmetric dimethylarginine concentration: increase (FC = 1.13 - 1.35)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC7A2 leads to the increase of asymmetric dimethylarginine levels compared with control group.
            Homo-L-arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Overexpression of SLC7A2
                      Induced Change Homo-L-arginine concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Coronary artery disease [ICD-11: BA80]
                      Details It is reported that overexpression of SLC7A2 leads to the increase of homo-L-arginine levels compared with control group.
References
1 Transport of asymmetric dimethylarginine (ADMA) by cationic amino acid transporter 2 (CAT2), organic cation transporter 2 (OCT2) and multidrug and toxin extrusion protein 1 (MATE1). Amino Acids. 2013 Oct;45(4):989-1002.
2 The prognostic biomarker L-homoarginine is a substrate of the cationic amino acid transporters CAT1, CAT2A and CAT2B. Sci Rep. 2017 Jul 6;7(1):4767.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.