Details of Protein
General Information of Protein (ID: PRT00624) | |||||
---|---|---|---|---|---|
Name | Cationic amino acid transporter 2 (SLC7A2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
CAT-2; CAT2; 20.5; Low affinity cationic amino acid transporter 2; Solute carrier family 7 member 2; T-cell early activation protein; TEA; Slc7a2; Atrc2; Tea
|
||||
Gene Name | Slc7a2 | Gene ID | |||
UniProt ID | |||||
Family | Amino acid/polyamine transporter (AAPT) | ||||
TC Number | TC: 2.A.3.3.2 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MIPCRAVLTFARCLIRRKIVTLDSLEDSKLCRCLTTVDLIALGVGSTLGAGVYVLAGEVA
KADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLI LSYVIGTSSVARAWSGTFDELLNKQIGQFFKTYFKMNYTGLAEYPDFFAVCLVLLLAGLL SFGVKESAWVNKFFTAINILVLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENG TSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCF MAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVRWSPAKYVVSAGSLCALSTSLLGSMFPL PRILFAMARDGLLFRFLARVSKRQSPVAATMTAGVISAVMAFLFDLKALVDMMSIGTLMA YSLVAACVLILRYQPGLCYDQPKYTPEKETLESCTNATLKSESQVTMLQGQGFSLRTLFS PSALPTRQSASLVSFLVGFLAFLILGLSILTTYGVQAIARLEAWSLALLALFLVLCVAVI LTIWRQPQNQQKVAFMVPFLPFLPAFSILVNIYLMVQLSADTWIRFSIWMALGFLIYFAY GIRHSLEGNPRDEEDDEDAFSDNINAATEEKSAMQANDHHQRNLSLPFILHEKTSEC |
||||
Function | Isoform 1 functions as low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Isoform 2 also functions as permease that mediates the transport of the cationic amino acids (arginine, lysine and ornithine), but it has much higher affinity for arginine than isoform 1. May play a role in classical or alternative activation of macrophages via its role in arginine transport. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of Slc7a2 | |||||
Induced Change | Arginine concentration: increase (FC = 12 - 20) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that overexpression of Slc7a2 leads to the increase of arginine levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Human cationic amino acid transporters hCAT-1, hCAT-2A, and hCAT-2B: three related carriers with distinct transport properties. Biochemistry. 1997 May 27;36(21):6462-8. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.