Details of Protein
General Information of Protein (ID: PRT00587) | |||||
---|---|---|---|---|---|
Name | Solute carrier family 19 member 3 (SLC19A3) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
ThTr-2; ThTr2; Solute carrier family 19 member 3; SLC19A3
|
||||
Gene Name | SLC19A3 | Gene ID | |||
UniProt ID | |||||
Family | Reduced folate carrier (RFC) | ||||
TC Number | TC: 2.A.48.1.4 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MDCYRTSLSSSWIYPTVILCLFGFFSMMRPSEPFLIPYLSGPDKNLTSAEITNEIFPVWT
YSYLVLLLPVFVLTDYVRYKPVIILQGISFIITWLLLLFGQGVKTMQVVEFFYGMVTAAE VAYYAYIYSVVSPEHYQRVSGYCRSVTLAAYTAGSVLAQLLVSLANMSYFYLNVISLASV SVAFLFSLFLPMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILST SGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKRLFYWSLWWAFATAGFNQVLNYVQ ILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGYVKVNWDLLGELALVVFSVVNAGSL FLMHYTANIWACYAGYLIFKSSYMLLITIAVFQIAVNLNVERYALVFGINTFIALVIQTI MTVIVVDQRGLNLPVSIQFLVYGSYFAVIAGIFLMRSMYITYSTKSQKDVQSPAPSENPD VSHPEEESNIIMSTKL |
||||
Function | Mediates high affinity thiamine uptake, probably via a proton anti-port mechanism. Has no folate transport activity. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organoheterocyclic compounds | ||||||
Thiamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of SLC19A3 | |||||
Induced Change | Thiamine concentration: increase (FC = 3.5) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that overexpression of SLC19A3 leads to the increase of thiamine levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | SLC19A3 encodes a second thiamine transporter ThTr2. Biochim Biophys Acta. 2001 Nov 29;1537(3):175-8. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.