Details of Protein

General Information of Protein (ID: PRT00579)
Name Solute carrier family 22 member 13 (SLC22A13)
Synonyms   Click to Show/Hide Synonyms of This Protein
Organic cation transporter-like 3; ORCTL-3; SLC22A13; OCTL1; ORCTL3
Gene Name SLC22A13 Gene ID
9390
UniProt ID
Q9Y226
Family Organic ion transporter (OIT)
TC Number   TC: 2.A.1.19.17  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Organic Cation Transporter (OCT) Family (The SLC22A family including OCT1-3, OCTN1-3 and OAT1-5 of H. sapiens)
TC: 2.A.1.19.17
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAQFVQVLAEIGDFGRFQIQLLILLCVLNFLSPFYFFAHVFMVLDEPHHCAVAWVKNHTF
NLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRL
PSLKNEFNLVCDRKHLKDTTQSVFMAGLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGL
ATAFVPSFELYMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVL
AGLAYGFRNWRLLQITGTAPGLLLFFYFWALPESARWLLTRGRMDEAIQLIQKAASVNRR
KLSPELMNQLVPEKTGPSGNALDLFRHPQLRKVTLIIFCVWFVDSLGYYGLSLQVGDFGL
DVYLTQLIFGAVEVPARCSSIFMMQRFGRKWSQLGTLVLGGLMCIIIIFIPADLPVVVTM
LAVVGKMATAAAFTISYVYSAELFPTILRQTGMGLVGIFSRIGGILTPLVILLGEYHAAL
PMLIYGSLPIVAGLLCTLLPETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSS
PGVAFVSSTYF
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Benzenoids
            4-Aminohippuric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC22A13
                      Induced Change 4-Aminohippuric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC22A13 leads to the increase of 4-aminohippuric acid levels compared with control group.
      Organoheterocyclic compounds
            Nicotinic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC22A13
                      Induced Change Nicotinic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC22A13 leads to the increase of nicotinic acid levels compared with control group.
            Uric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC22A13
                      Induced Change Uric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC22A13 leads to the increase of uric acid levels compared with control group.
References
1 Intestinal dehydroascorbic acid (DHA) transport mediated by the facilitative sugar transporters, GLUT2 and GLUT8. J Biol Chem. 2013 Mar 29;288(13):9092-101.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.