Details of Protein
General Information of Protein (ID: PRT00574) | |||||
---|---|---|---|---|---|
Name | Solute carrier family 35 member F3 (SLC35F3) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Putative thiamine transporter SLC35F3; SLC35F3
|
||||
Gene Name | SLC35F3 | Gene ID | |||
UniProt ID | |||||
Family | Drug/metabolite transporter (DMT) | ||||
TC Number | TC: 2.A.7.24.8 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSR
AQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHV CKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDV SVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVA SASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDI PWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTSQIVFNGVRVI AIIIIGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFA R |
||||
Function | May be a thiamine transporter. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organoheterocyclic compounds | ||||||
Thiamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Overexpression of SLC35F3 | |||||
Induced Change | Thiamine concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Essential hypertension [ICD-11: BA00] | |||||
Details | It is reported that overexpression of SLC35F3 leads to the increase of thiamine levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Genetic implication of a novel thiamine transporter in human hypertension. J Am Coll Cardiol. 2014 Apr 22;63(15):1542-55. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.