Details of Protein
| General Information of Protein (ID: PRT00574) | |||||
|---|---|---|---|---|---|
| Name | Solute carrier family 35 member F3 (SLC35F3) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Putative thiamine transporter SLC35F3; SLC35F3
|
||||
| Gene Name | SLC35F3 | Gene ID | |||
| UniProt ID | |||||
| Family | Drug/metabolite transporter (DMT) | ||||
| TC Number | TC: 2.A.7.24.8 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSR
AQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHV CKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDV SVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVA SASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDI PWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTSQIVFNGVRVI AIIIIGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFA R |
||||
| Function | May be a thiamine transporter. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organoheterocyclic compounds | ||||||
| Thiamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Overexpression of SLC35F3 | |||||
| Induced Change | Thiamine concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Essential hypertension [ICD-11: BA00] | |||||
| Details | It is reported that overexpression of SLC35F3 leads to the increase of thiamine levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Genetic implication of a novel thiamine transporter in human hypertension. J Am Coll Cardiol. 2014 Apr 22;63(15):1542-55. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

