Details of Protein
| General Information of Protein (ID: PRT00457) | |||||
|---|---|---|---|---|---|
| Name | Pigment epithelium-derived factor (SERPINF1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
PEDF; Cell proliferation-inducing gene 35 protein; EPC-1; Serpin F1; PIG35; SERPINF1; PEDF
|
||||
| Gene Name | SERPINF1 | Gene ID | |||
| UniProt ID | |||||
| Family | Serpin (Serp) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN
FGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHG TYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEI NNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVR VPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHD IDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRA GFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP |
||||
| Structure | |||||
| Function | Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| L-Dopa | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | L-Dopa addition (72 hours) | |||||
| Induced Change | SERPINF1 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Albinism [ICD-11: EC23] | |||||
| Details | It is reported that L-Dopa addition causes the increase of SERPINF1 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | L-DOPA is an endogenous ligand for OA1. PLoS Biol. 2008 Sep 30;6(9):e236. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

