Details of Protein
General Information of Protein (ID: PRT00457) | |||||
---|---|---|---|---|---|
Name | Pigment epithelium-derived factor (SERPINF1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
PEDF; Cell proliferation-inducing gene 35 protein; EPC-1; Serpin F1; PIG35; SERPINF1; PEDF
|
||||
Gene Name | SERPINF1 | Gene ID | |||
UniProt ID | |||||
Family | Serpin (Serp) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN
FGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHG TYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEI NNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVR VPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHD IDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRA GFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP |
||||
Structure | |||||
Function | Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
L-Dopa | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | L-Dopa addition (72 hours) | |||||
Induced Change | SERPINF1 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Albinism [ICD-11: EC23] | |||||
Details | It is reported that L-Dopa addition causes the increase of SERPINF1 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | L-DOPA is an endogenous ligand for OA1. PLoS Biol. 2008 Sep 30;6(9):e236. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.