Details of Protein

General Information of Protein (ID: PRT00319)
Name Kynureninase (KYNU)
Synonyms   Click to Show/Hide Synonyms of This Protein
L-kynurenine hydrolase; KYNU
Gene Name KYNU Gene ID
8942
UniProt ID
Q16719
Family Hydrolases (EC 3)
EC Number   EC: 3.7.1.3  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Carbon-carbon hydrolase
Carbon-carbon hydrolase
EC: 3.7.1.3
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLS
LVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLM
KDIVGANEKEIALMNALTVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHG
LNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAG
QAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
ALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALRKK
SVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEK
RGVVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN
Structure
2HZP ; 3E9K
Function Catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively. Has a preference for the L-3-hydroxy form. Also has cysteine-conjugate-beta-lyase activity.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            NAD Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU
                      Induced Change NAD concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary methemoglobinemia [ICD-11: 3A92]
                      Details It is reported that mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU leads to the decrease of NAD levels compared with control group.
      Organic oxygen compounds
            L-3-Hydroxykynurenine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU
                      Induced Change L-3-Hydroxykynurenine concentration: increase (FC = 160.7)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary methemoglobinemia [ICD-11: 3A92]
                      Details It is reported that mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU leads to the increase of L-3-hydroxykynurenine levels compared with control group.
            L-Kynurenine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU
                      Induced Change L-Kynurenine concentration: increase (FC = 2.3)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary methemoglobinemia [ICD-11: 3A92]
                      Details It is reported that mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU leads to the increase of L-kynurenine levels compared with control group.
      Organoheterocyclic compounds
            Picolinic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU
                      Induced Change Picolinic acid concentration: increase (FC = 1.4)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary methemoglobinemia [ICD-11: 3A92]
                      Details It is reported that mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU leads to the increase of picolinic acid levels compared with control group.
            Tryptophan Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU
                      Induced Change Tryptophan concentration: increase (FC = 1.2)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary methemoglobinemia [ICD-11: 3A92]
                      Details It is reported that mutation (c.468T-A, c.1045_1051delTTTAAGC) of KYNU leads to the increase of tryptophan levels compared with control group.
References
1 NAD Deficiency, Congenital Malformations, and Niacin Supplementation. N Engl J Med. 2017 Aug 10;377(6):544-552.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.