Details of Protein

General Information of Protein (ID: PRT00310)
Name 3-hydroxyanthranilate oxygenase (HAAO)
Synonyms   Click to Show/Hide Synonyms of This Protein
3-hydroxyanthranilate oxygenase; 3-HAO; 3-hydroxyanthranilic acid dioxygenase; HAD; Haao
Gene Name Haao Gene ID
107766
UniProt ID
Q78JT3
Family Oxidoreductases (EC 1)
EC Number   EC: 1.13.11.6  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen single donor oxidoreductase
Oxygen single donor oxidoreductase
EC: 1.13.11.6
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MERRVRVKSWVEENRASFQPPVCNKLMHQEQLKIMFVGGPNTRKDYHIEEGEEVFYQLEG
DMILRVLEQGQHRDVPIRQGEIFLLPARVPHSPQRFANTMGLVIERRRLESELDGLRYYV
GDTEDVLFEKWFHCKDLGTQLAPIIQEFFHSEQYRTGKPNPDQLLKELPFPLNTRSIMKP
MSLKAWLDGHSRELQAGTSLSLFGDSYETQVIAHGQGSSKGPRQDVDVWLWQQEGSSKVT
MGGQCIALAPDDSLLVPAGTSYVWERAQGSVALSVTQDPARKKPWW
Function Catalyzes the oxidative ring opening of 3-hydroxyanthranilate to 2-amino-3-carboxymuconate semialdehyde, which spontaneously cyclizes to quinolinate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Benzenoids
            3-Hydroxyanthranilic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of Haao
                      Induced Change 3-Hydroxyanthranilic acid concentration: increase (FC > 100)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hereditary methemoglobinemia [ICD-11: 3A92]
                      Details It is reported that knockout of Haao leads to the increase of 3-hydroxyanthranilic acid levels compared with control group.
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Methionine decrease (504 hours)
                      Induced Change HAAO protein expression levels: decrease (FC = 0.30)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Fatty liver disease [ICD-11: DB92]
                      Details It is reported that methionine decrease causes the decrease of HAAO protein expression compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Methionine addition (5 hours)
                      Induced Change HAAO protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hyperhomocysteinaemia [ICD-11: 3B61]
                      Details It is reported that methionine addition causes the increase of HAAO protein expression compared with control group.
References
1 NAD Deficiency, Congenital Malformations, and Niacin Supplementation. N Engl J Med. 2017 Aug 10;377(6):544-552.
2 Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577.
3 Regulatory cross-talk of mouse liver polyamine and methionine metabolic pathways: a systemic approach to its physiopathological consequences. Amino Acids. 2012 Feb;42(2-3):577-95.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.