Details of Protein

General Information of Protein (ID: PRT00293)
Name Isocitrate dehydrogenase NAD 3 beta (IDH3B)
Synonyms   Click to Show/Hide Synonyms of This Protein
Isocitric dehydrogenase subunit beta; NAD(+)-specific ICDH subunit beta; IDH3B
Gene Name IDH3B Gene ID
3420
UniProt ID
O43837
Family Oxidoreductases (EC 1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVG
PELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPME
YKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESAR
GVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELY
PKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEY
AVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRT
RDMGGYSTTTDFIKSVIGHLQTKGS
Structure
6KDE ; 6KDF ; 6KDY ; 6KE3 ; 7CE3
Function Plays a structural role to facilitate the assembly and ensure the full activity of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockdown (shRNA) of IDH3B
                      Induced Change Glucose concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Oesophagus carcinoma [ICD-11: 2E60]
                      Details It is reported that knockdown of IDH3B leads to the decrease of glucose levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of IDH3B
                      Induced Change Glucose concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Oesophagus carcinoma [ICD-11: 2E60]
                      Details It is reported that overexpression of IDH3B leads to the increase of glucose levels compared with control group.
References
1 APC/C-CDH1-Regulated IDH3 Coordinates with the Cell Cycle to Promote Cell Proliferation. Cancer Res. 2019 Jul 1;79(13):3281-3293.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.