Details of Protein
General Information of Protein (ID: PRT00152) | |||||
---|---|---|---|---|---|
Name | Serine methylase (SHMT1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
SHMT; Serine hydroxymethyltransferase, cytosolic; Glycine hydroxymethyltransferase; SHMT1
|
||||
Gene Name | SHMT1 | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.1.2.1 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRA
VLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSG SPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY INYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGV VPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPGL QGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLIL VDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQK VAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGL |
||||
Structure | |||||
Function | Interconversion of serine and glycine. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine decrease (48 hours) | |||||
Induced Change | SHMT1 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Cervical Cancer [ICD-11: 2C77] ... | |||||
Details | It is reported that glutamine decrease causes the increase of SHMT1 protein expression compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine decrease (48 hours) | |||||
Induced Change | SHMT1 mRNA levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Cervical Cancer [ICD-11: 2C77] ... | |||||
Details | It is reported that glutamine decrease causes the increase of SHMT1 mRNA levels compared with control group. | |||||
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glucose decrease (48 hours) | |||||
Induced Change | SHMT1 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Cervical Cancer [ICD-11: 2C77] ... | |||||
Details | It is reported that glucose decrease causes the increase of SHMT1 protein expression compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glucose decrease (48 hours) | |||||
Induced Change | SHMT1 mRNA levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Cervical Cancer [ICD-11: 2C77] ... | |||||
Details | It is reported that glucose decrease causes the increase of SHMT1 mRNA levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Cell Res. 2015 Apr;25(4):429-44. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.