Details of Protein
General Information of Protein (ID: PRT00127) | |||||
---|---|---|---|---|---|
Name | L-lactate dehydrogenase C chain (LDHC) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
LDH-C; LDH testis subunit; LDH-X; Ldhc; Ldh-3; Ldh3
|
||||
Gene Name | Ldhc | Gene ID | |||
UniProt ID | |||||
Family | Oxidoreductases (EC 1) | ||||
EC Number | EC: 1.1.1.27 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MSTVKEQLIQNLVPEDKLSRCKITVVGVGNVGMACAISILLKGLADELALVDADTNKLRG
EALDLLHGSLFLSTPKIVFGKDYNVSANSKLVIITAGARMVSGETRLDLLQRNVAIMKAI VPGIVQNSPDCKIIIVTNPVDILTYVVWKISGFPVGRVIGSGCNLDSARFRYLIGEKLGV NPTSCHGWVLGEHGDSSVPIWSGVNVAGVTLKSLNPAIGTDSDKEHWKNVHKQVVEGGYE VLNMKGYTSWAIGLSVTDLARSILKNLKRVHPVTTLVKGFHGIKEEVFLSIPCVLGQSGI TDFVKVNMTAEEEGLLKKSADTLWNMQKDLQL |
||||
Structure | |||||
Function | Possible role in sperm motility. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
2-Hydroxyglutarate | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of Ldhc | |||||
Induced Change | 2-Hydroxyglutarate concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockout of Ldhc leads to the decrease of 2-hydroxyglutarate levels compared with control group. | |||||
Oxoglutaric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of Ldhc | |||||
Induced Change | Oxoglutaric acid concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockout of Ldhc leads to the increase of oxoglutaric acid levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Lactate dehydrogenase C is required for the protein expression of a sperm-specific isoform of lactate dehydrogenase A. J Biochem. 2019 Apr 1;165(4):323-334. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.