Details of Protein
| General Information of Protein (ID: PRT00127) | |||||
|---|---|---|---|---|---|
| Name | L-lactate dehydrogenase C chain (LDHC) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
LDH-C; LDH testis subunit; LDH-X; Ldhc; Ldh-3; Ldh3
|
||||
| Gene Name | Ldhc | Gene ID | |||
| UniProt ID | |||||
| Family | Oxidoreductases (EC 1) | ||||
| EC Number | EC: 1.1.1.27 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MSTVKEQLIQNLVPEDKLSRCKITVVGVGNVGMACAISILLKGLADELALVDADTNKLRG
EALDLLHGSLFLSTPKIVFGKDYNVSANSKLVIITAGARMVSGETRLDLLQRNVAIMKAI VPGIVQNSPDCKIIIVTNPVDILTYVVWKISGFPVGRVIGSGCNLDSARFRYLIGEKLGV NPTSCHGWVLGEHGDSSVPIWSGVNVAGVTLKSLNPAIGTDSDKEHWKNVHKQVVEGGYE VLNMKGYTSWAIGLSVTDLARSILKNLKRVHPVTTLVKGFHGIKEEVFLSIPCVLGQSGI TDFVKVNMTAEEEGLLKKSADTLWNMQKDLQL |
||||
| Structure | |||||
| Function | Possible role in sperm motility. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| 2-Hydroxyglutarate | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ldhc | |||||
| Induced Change | 2-Hydroxyglutarate concentration: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Ldhc leads to the decrease of 2-hydroxyglutarate levels compared with control group. | |||||
| Oxoglutaric acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of Ldhc | |||||
| Induced Change | Oxoglutaric acid concentration: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of Ldhc leads to the increase of oxoglutaric acid levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Lactate dehydrogenase C is required for the protein expression of a sperm-specific isoform of lactate dehydrogenase A. J Biochem. 2019 Apr 1;165(4):323-334. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

