Details of Protein

General Information of Protein (ID: PRT00107)
Name Prokineticin-1 (PROK1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Endocrine-gland-derived vascular endothelial growth factor; EG-VEGF; Mambakine; UNQ600/PRO1186
Gene Name PROK1 Gene ID
84432
UniProt ID
P58294
Family Prokineticin (Prok)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEEC
HPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Function Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose decrease (36 hours)
                      Induced Change PROK1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that glucose decrease causes the decrease of PROK1 protein expression compared with control group.
References
1 Glucose withdrawal induces Endothelin 1 release with significant angiogenic effect from first trimester (FTM), but not term human umbilical cord perivascular cells (HUCPVC). Angiogenesis. 2020 May;23(2):131-144.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.