Details of Protein
| General Information of Protein (ID: PRT00084) | |||||
|---|---|---|---|---|---|
| Name | Insulin-1 (INS1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Ins1; Ins-1
|
||||
| Gene Name | Ins1 | Gene ID | |||
| UniProt ID | |||||
| Family | Insulin (Insu) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MALWMRFLPLLALLVLWEPKPAQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVED
PQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN |
||||
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1], [2] | ||||
| Introduced Variation | Leucine addition (288 hours) | |||||
| Induced Change | INS1 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual ... | |||||
| Details | It is reported that leucine addition causes the increase of INS1 protein expression compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[2] | ||||
| Introduced Variation | Leucine addition (72 hours) | |||||
| Induced Change | INS1 mRNAlevel levels: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Type 2 diabetes mellitus [ICD-11: 5A11] | |||||
| Details | It is reported that leucine addition causes the decrease of INS1 mRNA levels compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

