Details of Protein
| General Information of Protein (ID: PRT00081) | |||||
|---|---|---|---|---|---|
| Name | Cholecystokinin (CCK) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
CCK; Cck
|
||||
| Gene Name | Cck | Gene ID | |||
| UniProt ID | |||||
| Family | Gastrin/cholecystokinin (GCK) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MKSGVCLCVVMAVLAAGALAQPVVPAEATDPVEQRAQEAPRRQLRAVLRTDGEPRARLGA
LLARYIQQVRKAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS |
||||
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Lipids and lipid-like molecules | ||||||
| Docosahexaenoic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Docosahexaenoic acid addition (0.33 hours) | |||||
| Induced Change | CCK protein expression levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that docosahexaenoic acid addition causes the increase of CCK protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | TRPA1 is a polyunsaturated fatty acid sensor in mammals. PLoS One. 2012;7(6):e38439. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.