Details of Protein
General Information of Protein (ID: PRT00062) | |||||
---|---|---|---|---|---|
Name | Adenosine deaminase 2 (ADA2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Cat eye syndrome critical region protein 1; ADA2; ADGF; CECR1; IDGFL
|
||||
Gene Name | ADA2 | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
EC Number | EC: 3.5.4.4 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MLVDGPSERPALCFLLLAVAMSFFGSALSIDETRAHLLLKEKMMRLGGRLVLNTKEELAN
ERLMTLKIAEMKEAMRTLIFPPSMHFFQAKHLIERSQVFNILRMMPKGAALHLHDIGIVT MDWLVRNVTYRPHCHICFTPRGIMQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDD SLLRNFTLVTQHPEVIYTNQNVVWSKFETIFFTISGLIHYAPVFRDYVFRSMQEFYEDNV LYMEIRARLLPVYELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAV IAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGET DWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSD LRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSI KYSTLLESEKNTFMEIWKKRWDKFIADVATK |
||||
Structure | |||||
Function | Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Nucleosides, nucleotides, and analogues | ||||||
Deoxyinosine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockdown (siRNA) of ADA2 | |||||
Induced Change | Deoxyinosine concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockdown of ADA2 leads to the increase of deoxyinosine levels compared with control group. | |||||
Organoheterocyclic compounds | ||||||
Hypoxanthine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockdown (siRNA) of ADA2 | |||||
Induced Change | Hypoxanthine concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockdown of ADA2 leads to the increase of hypoxanthine levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Cellular sensing of extracellular purine nucleosides triggers an innate IFN- response. Sci Adv. 2020 Jul 22;6(30):eaba3688. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.