Details of Protein
General Information of Protein (ID: PRT00024) | |||||
---|---|---|---|---|---|
Name | Factor HNF-4-alpha (HNF4A) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
HNF-4-alpha; Nuclear receptor subfamily 2 group A member 1; Transcription factor 14; TCF-14; Transcription factor HNF-4; Hnf4a; Hnf-4; Hnf4; Nr2a1; Tcf14
|
||||
Gene Name | Hnf4a | Gene ID | |||
UniProt ID | |||||
Family | Nuclear hormone receptor (NHR) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MRLSKTLADMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNSSNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPISGINGDIRAKK IANITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVFK DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAK GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL FGMAKIDNLLQEMLLGGSASDAPHAHHPLHPHLMQEHMGTNVIVANTMPSHLSNGQMCEW PRPRGQAATPETPQPSPPSGSGSESYKLLPGAITTIVKPPSAIPQPTITKQEAI |
||||
Structure | |||||
Function | Transcriptional regulator which controls the expression of hepatic genes during the transition of endodermal cells to hepatic progenitor cells, facilitating the recruitment of RNA pol II to the promoters of target genes. Activates the transcription of CYP2C38. Represses the CLOCK-ARNTL/BMAL1 transcriptional activity and is essential for circadian rhythm maintenance and period regulation in the liver and colon cells. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Lipids and lipid-like molecules | ||||||
Linoleic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Linoleic acid addition (4 hours) | |||||
Induced Change | HNF4A protein activity levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Type 1 diabetes mellitus [ICD-11: 5A10] | |||||
Details | It is reported that linoleic acid addition causes the increase of HNF4A protein activity compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Identification of an endogenous ligand bound to a native orphan nuclear receptor. PLoS One. 2009;4(5):e5609. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.