Details of Protein
| General Information of Protein (ID: PRT00006) | |||||
|---|---|---|---|---|---|
| Name | N-acylneuraminate cytidylyltransferase (CMAS) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
CMP-N-acetylneuraminic acid synthase; CMP-NeuNAc synthase; CMAS
|
||||
| Gene Name | CMAS | Gene ID | |||
| UniProt ID | |||||
| Family | Transferases (EC 2) | ||||
| EC Number | EC: 2.7.7.43 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPL
KNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSS TSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRW SEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEM RAEHSVDIDVDIDWPIAEQRVLRYGYFGKEKLKEIKLLVCNIDGCLTNGHIYVSGDQKEI ISYDVKDAIGISLLKKSGIEVRLISERACSKQTLSSLKLDCKMEVSVSDKLAVVDEWRKE MGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEH ICLLMEKVNNSCQK |
||||
| Function | Catalyzes the activation of N-acetylneuraminic acid (NeuNAc) to cytidine 5'-monophosphate N-acetylneuraminic acid (CMP-NeuNAc), a substrate required for the addition of sialic acid. Has some activity toward NeuNAc, N-glycolylneuraminic acid (Neu5Gc) or 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN). | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| N-Acetylneuraminic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockout of CMAS | |||||
| Induced Change | N-Acetylneuraminic acid concentration: increase (FC = 30) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that knockout of CMAS leads to the increase of N-acetylneuraminic acid levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Sialylation Is Dispensable for Early Murine Embryonic Development in Vitro. Chembiochem. 2017 Jul 4;18(13):1305-1316. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.