Details of Protein

General Information of Protein (ID: PRT01678)
Name eIF4E-binding protein 1 (EIF4EBP1)
Synonyms   Click to Show/Hide Synonyms of This Protein
4E-BP1; eIF4E-binding protein 1; Phosphorylated heat- and acid-stable protein regulated by insulin 1; PHAS-I; EIF4EBP1
Gene Name EIF4EBP1 Gene ID
1978
UniProt ID
Q13541
Family Translation initiation factor (TIF)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Structure
1EJ4 ; 1EJH ; 1WKW ; 2JGB ; 2JGC ; 2V8W ; 2V8X ; 2V8Y ; 3HXG ; 3HXI ; 3M93 ; 3M94 ; 3U7X ; 4UED ; 5BXV ; 5EKV ; 5NVN ; 5WBJ ; 6BCU ; 6BCX
Function Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine decrease (6 hours)
                      Induced Change EIF4EBP1 protein phosphorylation levels: decrease (FC = p-4E-BP1)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine decrease causes the decrease of EIF4EBP1 protein phosphorylation compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Glutamine addition (96 hours)
                      Induced Change EIF4EBP1 protein phosphorylation levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that glutamine addition causes the increase of EIF4EBP1 protein phosphorylation compared with control group.
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [3]
                      Introduced Variation Leucine addition (1 hours)
                      Induced Change EIF4EBP1 protein phosphorylation levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that leucine addition causes the increase of EIF4EBP1 protein phosphorylation compared with control group.
References
1 Effects of essential amino acids or glutamine deprivation on intestinal permeability and protein synthesis in HCT-8 cells: involvement of GCN2 and mTOR pathways. Amino Acids. 2012 Jan;42(1):375-83.
2 Regulation of protein turnover by L-glutamine in porcine intestinal epithelial cells. J Nutr Biochem. 2012 Aug;23(8):1012-7.
3 Nutrient signalling in the regulation of human muscle protein synthesis. J Physiol. 2007 Jul 15;582(Pt 2):813-23.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.