Details of Protein
| General Information of Protein (ID: PRT01677) | |||||
|---|---|---|---|---|---|
| Name | Eukaryotic translation initiation factor 4B (EIF4B) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
eIF-4B; Eif4b
|
||||
| Gene Name | Eif4b | Gene ID | |||
| UniProt ID | |||||
| Family | Translation initiation factor (TIF) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVPKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEDSIKDFFRGLN ISAVRLPREPSNPDRLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRD DRSFGRDRNRDSDKTDTDWRARPTTDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG YRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPRLNLKPRSAPKEDDASASTSQSSRAASI FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLDRRPRERHPSWRSEETQERERSRT GSESSQTGASATSGRNTRRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPK ENAWVKRSSNPPARSQSSDTEQPSPTSGGGKVAAVQPPEEGPSRKDGNKVDVVGATQGQA GSCSRGPGDGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG EDEDEGDDCTE |
||||
| Function | Required for the binding of mRNA to ribosomes. Functions in close association with EIF4-F and EIF4-A. Binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP. Promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Leucine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Leucine decrease (2 hours) | |||||
| Induced Change | EIF4B protein phosphorylation levels: decrease | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that leucine decrease causes the decrease of EIF4B protein phosphorylation compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Phospho-proteomic approach to identify new targets of leucine deprivation in muscle cells. Anal Biochem. 2008 Oct 1;381(1):148-50. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.