Details of Protein

General Information of Protein (ID: PRT01675)
Name Eukaryotic translation initiation factor 1A (EIF1A)
Synonyms   Click to Show/Hide Synonyms of This Protein
eIF1; Protein translation factor SUI1 homolog; Eif1; Sui1; Sui1-rs1
Gene Name Eif1 Gene ID
20918
UniProt ID
P48024
Family Translation initiation factor (TIF)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV
KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF
Function Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change EIF1 protein abundance levels: increase (FC = 1.75)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of EIF1 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.