General Information of Protein (ID: PRT01647)
Name Heat shock protein 26 (HSP26)
Synonyms   Click to Show/Hide Synonyms of This Protein
26 kDa heat shock protein; YBR072W; YBR0714; HSP26
Gene Name HSP26 Gene ID
852364
UniProt ID
P15992
Family Heat shock protein (HSP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSFNSPFFDFFDNINNEVDAFNRLLGEGGLRGYAPRRQLANTPAKDSTGKEVARPNNYAG
ALYDPRDETLDDWFDNDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPGVKSKKDID
IEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVITLPDYPGVDADNIKADYA
NGVLTLTVPKLKPQKDGKNHVKKIEVSSQESWGN
Function Not known. One of the major polypeptides produced on heat shock.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose addition (1.50 hours)
                      Induced Change HSP26 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that glucose addition causes the increase of HSP26 protein expression compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.