General Information of Protein (ID: PRT01644)
Name Hemoglobin beta-2 chain (HBB-B2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Beta-2-globin; Hemoglobin subunit beta-2 ; Hemoglobin beta-minor chain; Hbb-b2
Gene Name Hbb-b2 Gene ID
15130
UniProt ID
P02089
Family Globin (Glo)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MVHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPK
VKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLG
KDFTPAAQAAFQKVVAGVATALAHKYH
Structure
1FNE ; 1FNG ; 1I3R
Function Involved in oxygen transport from the lung to the various peripheral tissues.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change HBB-B2 protein abundance levels: decrease (FC = 2.29)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the decrease of HBB-B2 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.