Details of Protein
| General Information of Protein (ID: PRT01635) | |||||
|---|---|---|---|---|---|
| Name | B-cell translocation gene 1 (BTG1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
B-cell translocation gene 1 protein; BTG1
|
||||
| Gene Name | BTG1 | Gene ID | |||
| UniProt ID | |||||
| Family | B-cell translocation gene (BTG) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEK
PCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGS ICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG |
||||
| Function | Anti-proliferative protein. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose addition (16 hours) | |||||
| Induced Change | BTG1 protein expression levels: increase (FC = 4) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that glucose addition causes the increase of BTG1 protein expression compared with control group. | |||||
| Mannitol | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Mannitol addition (16 hours) | |||||
| Induced Change | BTG1 protein expression levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20] | |||||
| Details | It is reported that mannitol addition causes the increase of BTG1 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | High-glucose-induced changes in macrophage secretome: regulation of immune response. Mol Cell Biochem. 2019 Feb;452(1-2):51-62. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.