Details of Protein
| General Information of Protein (ID: PRT01630) | |||||
|---|---|---|---|---|---|
| Name | Annexin A3 (ANXA3) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
35-alpha calcimedin; Annexin III; Annexin-3; Inositol 1,2-cyclic phosphate 2-phosphohydrolase; Lipocortin III; Placental anticoagulant protein III; PAP-III; ANXA3; ANX3
|
||||
| Gene Name | ANXA3 | Gene ID | |||
| UniProt ID | |||||
| Family | Annexin (ANEX) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEY
QAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTR TSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQ ILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLY SAIKSDTSGDYEITLLKICGGDD |
||||
| Structure | |||||
| Function | Inhibitor of phospholipase A2, also possesses anti-coagulant properties. Also cleaves the cyclic bond of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine addition (24 hours) | |||||
| Induced Change | ANXA3 protein expression levels: decrease | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that glutamine addition causes the decrease of ANXA3 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Glutamine regulates the human epithelial intestinal HCT-8 cell proteome under apoptotic conditions. Mol Cell Proteomics. 2007 Oct;6(10):1671-9. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

