General Information of Protein (ID: PRT01625)
Name	Small EDRK-rich factor 2 (SERF2)
Synonyms	Click to Show/Hide Synonyms of This Protein Protein 4F5-related; 4F5rel; Serf2
Gene Name	Serf2		Gene ID	378702
UniProt ID	P84102
Family	Protein 4F5-related (PFR)
	Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence	MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK
Function	Positive regulator of amyloid protein aggregation and proteotoxicity. Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates.
Regulatory Network

Full List of Metabolite(s) Regulating This Protein
Organic oxygen compounds
Glucose		Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
Detailed Information	Metabo  Info click to show the details of this metabolite
Regulating Pair	Experim Info click to show the details of experiment for validating this pair					[1]
Introduced Variation	Glucose (low concentration) addition (17.50 hours)
Induced Change	SERF2 protein abundance levels: increase (FC = 2.31)
Summary	Introduced Variation         Induced Change
Disease Status	Cerebral stroke [ICD-11: 8B11]
Details	It is reported that low glucose addition causes the increase of SERF2 protein abundance compared with control group.

References
1	Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.