Details of Protein
General Information of Protein (ID: PRT01621) | |||||
---|---|---|---|---|---|
Name | Phosphoglycerate mutase 1 (PGAM1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
BPG-dependent PGAM 1; Phosphoglycerate mutase isozyme B; PGAM-B; CDABP0006; PGAM1; PGAMA
|
||||
Gene Name | PGAM1 | Gene ID | |||
UniProt ID | |||||
Family | Isomerases (EC 5) | ||||
EC Number | EC: 5.4.2.11 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR KAMEAVAAQGKAKK |
||||
Structure | |||||
Function | Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase), but with a reduced activity. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine decrease (48 hours) | |||||
Induced Change | PGAM1 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
Details | It is reported that glutamine decrease causes the increase of PGAM1 protein expression compared with control group. | |||||
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glucose decrease (48 hours) | |||||
Induced Change | PGAM1 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
Details | It is reported that glucose decrease causes the increase of PGAM1 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Cell Res. 2015 Apr;25(4):429-44. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.