Details of Protein
| General Information of Protein (ID: PRT01618) | |||||
|---|---|---|---|---|---|
| Name | UDP-glucose 4-epimerase (GALE) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; GALE
|
||||
| Gene Name | GALE | Gene ID | |||
| UniProt ID | |||||
| Family | Isomerases (EC 5) | ||||
| EC Number | EC: 5.1.3.2 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSV
EFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMK AHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNA VLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRD YIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARR EGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA |
||||
| Structure | |||||
| Function | Catalyzes two distinct but analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The reaction with UDP-Gal plays a critical role in the Leloir pathway of galactose catabolism in which galactose is converted to the glycolytic intermediate glucose 6-phosphate. It contributes to the catabolism of dietary galactose and enables the endogenous biosynthesis of both UDP-Gal and UDP-GalNAc when exogenous sources are limited. Both UDP-sugar interconversions are important in the synthesis of glycoproteins and glycolipids. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Arginine decrease (48 hours) | |||||
| Induced Change | GALE protein abundance levels: increase (FC = 2.2) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that arginine decrease causes the increase of GALE protein abundance compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

