Details of Protein
General Information of Protein (ID: PRT01616) | |||||
---|---|---|---|---|---|
Name | Lactoylglutathione lyase (GLO1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; Glo1
|
||||
Gene Name | Glo1 | Gene ID | |||
UniProt ID | |||||
Family | Lyases (EC 4) | ||||
EC Number | EC: 4.4.1.5 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQK
LDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNS DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKI ATII |
||||
Structure | |||||
Function | Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine addition (336 hours) | |||||
Induced Change | GLO1 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Hyperhomocysteinaemia [ICD-11: 3B61] | |||||
Details | It is reported that methionine addition causes the increase of GLO1 protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.