Details of Protein
General Information of Protein (ID: PRT01613) | |||||
---|---|---|---|---|---|
Name | Argininosuccinate lyase (ASL) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
ASAL; Arginosuccinase; ASL
|
||||
Gene Name | ASL | Gene ID | |||
UniProt ID | |||||
Family | Lyases (EC 4) | ||||
EC Number | EC: 4.3.2.1 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEM
DQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTD LRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVAL TRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVA EFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKA GRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENM GQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA |
||||
Structure | |||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Argininosuccinic acid | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockdown (shRNA) of ASL | |||||
Induced Change | Argininosuccinic acid concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockdown of ASL leads to the decrease of argininosuccinic acid levels compared with control group. | |||||
Organic oxygen compounds | ||||||
Glycerol | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockdown (shRNA) of ASL | |||||
Induced Change | Glycerol concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that knockdown of ASL leads to the decrease of glycerol levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Reversed argininosuccinate lyase activity in fumarate hydratase-deficient cancer cells. Cancer Metab. 2013 Mar 21;1(1):12. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.