Details of Protein
General Information of Protein (ID: PRT01590) | |||||
---|---|---|---|---|---|
Name | Uridine-cytidine kinase 2 (UCK2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
UCK 2; Cytidine monophosphokinase 2; Uridine monophosphokinase 2; Uck2; Umpk
|
||||
Gene Name | Uck2 | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.7.1.48 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILS
QDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRK EETVTIYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQ ILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGLSKRQTNG YLNGYTPSRKRQASESSSRPH |
||||
Function | Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glucose (low concentration) addition (17.50 hours) | |||||
Induced Change | UCK2 protein abundance levels: increase (FC = 1.55) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Cerebral stroke [ICD-11: 8B11] | |||||
Details | It is reported that low glucose addition causes the increase of UCK2 protein abundance compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.