Details of Protein
| General Information of Protein (ID: PRT01570) | |||||
|---|---|---|---|---|---|
| Name | Ubiquitin-conjugating enzyme E2 C (UBE2C) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
(E3-independent) E2 ubiquitin-conjugating enzyme C; E2 ubiquitin-conjugating enzyme C; UbcH10; Ubiquitin carrier protein C; Ubiquitin-protein ligase C; UBE2C; UBCH10
|
||||
| Gene Name | UBE2C | Gene ID | |||
| UniProt ID | |||||
| Family | Transferases (EC 2) | ||||
| EC Number | EC: 2.3.2.23 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKE KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
||||
| Structure | |||||
| Function | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine addition (12 hours) | |||||
| Induced Change | UBE2C protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
| Details | It is reported that glutamine addition causes the increase of UBE2C protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

