Details of Protein
| General Information of Protein (ID: PRT01567) | |||||
|---|---|---|---|---|---|
| Name | Glycine acetyltransferase (KBL) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
AKB ligase; 2-amino-3-ketobutyrate coenzyme A ligase; b3617; JW3592; kbl
|
||||
| Gene Name | kbl | Gene ID | |||
| UniProt ID | |||||
| Family | Transferases (EC 2) | ||||
| EC Number | EC: 2.3.1.29 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MRGEFYQQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPD
LIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFE TLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREAGARHVLIAT DGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITG TLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRD RLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVV PKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVIA |
||||
| Structure | |||||
| Function | Catalyzes the cleavage of 2-amino-3-ketobutyrate to glycine and acetyl-CoA. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glycine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glycine addition (0.5 hour) | |||||
| Induced Change | KBL protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Acute infection [ICD-11: 1D00] | |||||
| Details | It is reported that glycine addition causes the increase of KBL protein expression compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glycine addition (0.5 hour) | |||||
| Induced Change | KBL mRNA levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Acute infection [ICD-11: 1D00] | |||||
| Details | It is reported that glycine addition causes the increase of KBL mRNA levels compared with control group. | |||||
| Serine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair (1) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Serine addition (0.5 hour) | |||||
| Induced Change | KBL protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Acute infection [ICD-11: 1D00] | |||||
| Details | It is reported that serine addition causes the increase of KBL protein expression compared with control group. | |||||
| Regulating Pair (2) |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Serine addition (0.5 hour) | |||||
| Induced Change | KBL mRNA levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Acute infection [ICD-11: 1D00] | |||||
| Details | It is reported that serine addition causes the increase of KBL mRNA levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Glycine, serine and threonine metabolism confounds efficacy of complement-mediated killing. Nat Commun. 2019 Jul 25;10(1):3325. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

