Details of Protein
General Information of Protein (ID: PRT01567) | |||||
---|---|---|---|---|---|
Name | Glycine acetyltransferase (KBL) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
AKB ligase; 2-amino-3-ketobutyrate coenzyme A ligase; b3617; JW3592; kbl
|
||||
Gene Name | kbl | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.3.1.29 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MRGEFYQQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPD
LIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFE TLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREAGARHVLIAT DGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITG TLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRD RLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVV PKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVIA |
||||
Structure | |||||
Function | Catalyzes the cleavage of 2-amino-3-ketobutyrate to glycine and acetyl-CoA. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glycine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glycine addition (0.5 hour) | |||||
Induced Change | KBL protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Acute infection [ICD-11: 1D00] | |||||
Details | It is reported that glycine addition causes the increase of KBL protein expression compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glycine addition (0.5 hour) | |||||
Induced Change | KBL mRNA levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Acute infection [ICD-11: 1D00] | |||||
Details | It is reported that glycine addition causes the increase of KBL mRNA levels compared with control group. | |||||
Serine | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Serine addition (0.5 hour) | |||||
Induced Change | KBL protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Acute infection [ICD-11: 1D00] | |||||
Details | It is reported that serine addition causes the increase of KBL protein expression compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Serine addition (0.5 hour) | |||||
Induced Change | KBL mRNA levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Acute infection [ICD-11: 1D00] | |||||
Details | It is reported that serine addition causes the increase of KBL mRNA levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Glycine, serine and threonine metabolism confounds efficacy of complement-mediated killing. Nat Commun. 2019 Jul 25;10(1):3325. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.