Details of Protein

General Information of Protein (ID: PRT01562)
Name Ferritin (FTH1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Ferritin H subunit; Fth1; Fth
Gene Name Fth1 Gene ID
25319
UniProt ID
P19132
Family Oxidoreductases (EC 1)
EC Number   EC: 1.16.3.1  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Metal ion oxidoreductase
Oxygen acceptor oxidoreductase
EC: 1.16.3.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MTTASPSQVRQNYHQDSEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMRCALHLEKSVNQSLLELHK
LATDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMGAPESGMAEYLFDKHTLGHGD
ES
Function Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Citrulline Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Citrulline addition (1336 hours)
                      Induced Change FTH1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that citrulline addition causes the decrease of FTH1 protein expression compared with control group.
References
1 Citrulline Supplementation Induces Changes in Body Composition and Limits Age-Related Metabolic Changes in Healthy Male Rats. J Nutr. 2015 Jul;145(7):1429-37.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.