Details of Protein

General Information of Protein (ID: PRT01561)
Name Ferritin (FTH1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Ferritin H subunit; Cell proliferation-inducing gene 15 protein; OK/SW-cl.84; PIG15; FTH1; FTH; FTHL6
Gene Name FTH1 Gene ID
2495
UniProt ID
P02794
Family Oxidoreductases (EC 1)
EC Number   EC: 1.16.3.1  (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Metal ion oxidoreductase
Oxygen acceptor oxidoreductase
EC: 1.16.3.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK
LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD
NES
Structure
1FHA ; 2CEI ; 2CHI ; 2CIH ; 2CLU ; 2CN6 ; 2CN7 ; 2FHA ; 2IU2 ; 2Z6M ; 3AJO ; 3AJP ; 3AJQ ; 3ERZ ; 3ES3 ; 4DYX ; 4DYY ; 4DYZ ; 4DZ0 ; 4OYN ; 4Y08 ; 4YKH ; 4ZJK ; 5CMQ ; 5CMR ; 5GN8 ; 5GOU ; 5JKK ; 5JKL ; 5JKM ; 5N26 ; 5N27 ; 5UP7 ; 5UP8 ; 5UP9 ; 5VTD ; 5XB1 ; 5YI5 ; 5ZND ; 6B8F ; 6B8G ; 6FTV ; 6GSR ; 6H5I ; 6H6T ; 6H6U ; 6IPC ; 6IPO ; 6IPP ; 6IPQ ; 6J4A ; 6J7G ; 6JOB ; 6JPS ; 6KE2 ; 6KE4 ; 6M52 ; 6M54 ; 6WYF ; 6WYG ; 6WYH ; 6Z6U ; 6Z9E ; 6Z9F ; 7A6A ; 7A6B ; 7JGK ; 7JGL ; 7JGM ; 7JGN ; 7JGO ; 7JGP ; 7JGQ ; 7K26 ; 7K3V ; 7K3W
Function Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change FTH1 protein abundance levels: increase (FC = 1.35)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of FTH1 protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.