General Information of Protein (ID: PRT01538)
Name Type VI secretion system protein EvpC (EVPC)
Gene Name evpC Gene ID
58256100
UniProt ID
D0ZB32
Family Secretion system type VI (T4SE)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAFDTYIKLDKVDGESTDDKHKKWIEVLGFAWGAGNECTMESGTQGLNTGKAMMSVLRVT
KWMDCASVKLASAAVQGQNFPTLELEICTQAGDKFAFCIYKFTHVAVSSYQCSGATGGSD
RPQETIDFAYKEVTWEYVPQDQNGKAGGKIGPEGWSLITNKKK
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Alanine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Alanine addition (24 hours)
                      Induced Change EVPC protein abundance levels: decrease (FC = 0.08)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that alanine addition causes the decrease of EVPC protein abundance compared with control group.
References
1 Alanine Enhances Aminoglycosides-Induced ROS Production as Revealed by Proteomic Analysis. Front Microbiol. 2018 Jan 30;9:29.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.