Details of Protein
General Information of Protein (ID: PRT01509) | |||||
---|---|---|---|---|---|
Name | Rheumatoid arthritis-related antigen RA-A47 (SERPINH1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
47 kDa heat shock protein; Arsenic-transactivated protein 3; Cell proliferation-inducing gene 14 protein; Collagen-binding protein; Rheumatoid arthritis-related antigen RA-A47; CBP1; CBP2; HSP47; SERPINH2; PIG14
|
||||
Gene Name | SERPINH1 | Gene ID | |||
UniProt ID | |||||
Family | Serpin (Serp) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MRSLLLLSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAK
DQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSN STARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQT TDGKLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVMMMHRT GLYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKK AVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELD TDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL |
||||
Function | Binds specifically to collagen. Could be involved as a chaperone in the biosynthetic pathway of collagen. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Arginine decrease (48 hours) | |||||
Induced Change | SERPINH1 protein abundance levels: decrease (FC = 1.9) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Colon cancer [ICD-11: 2B90] | |||||
Details | It is reported that arginine decrease causes the decrease of SERPINH1 protein abundance compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.