Details of Protein

General Information of Protein (ID: PRT01492)
Name Outer membrane protein A (OMPA)
Synonyms   Click to Show/Hide Synonyms of This Protein
Outer membrane porin A
Gene Name ompA Gene ID
58255070
UniProt ID
D0ZFS8
Family OmpA-ompF porin (OOP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MKKTAIALAVALAGFATVAQAAPKDDTWYVGGKLGWSHFISNSFEDMGTTKSHPNQLGAG
AFFGYQANPYLGFEMGYDWLGRMGYTGDVNAKFKSQGVQLAAKLSYPLMDDLDVYTRLGG
MVWRSDIHGAADGGDYTSSHDTGVSPLAAIGVEYALNKDWATRLDYQYVNKVGTRSETGA
RPDNTMLSLGVVYRFGQDEVAAPAPIPAPAPAPVVETKRFTLKSDVLFNFNKYTLKAEGR
QALDQLYSQLSSMDPKDGSVVVLGYTDRIGSDQYNLKLSKQRAQTVVDYLVSKGIPADKI
AARGMGKADPVTGSTCDNVKPRAALINCLAPDRRVVIEVKGIKEEVSQPQA
Function With TolR probably plays a role in maintaining the position of the peptidoglycan cell wall in the periplasm. Acts as a porin with low permeability that allows slow penetration of small solutes; an internal gate slows down solute passage.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Alanine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Alanine addition (24 hours)
                      Induced Change OMPA protein abundance levels: increase (FC = 8.66)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that alanine addition causes the increase of OMPA protein abundance compared with control group.
References
1 Alanine Enhances Aminoglycosides-Induced ROS Production as Revealed by Proteomic Analysis. Front Microbiol. 2018 Jan 30;9:29.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.